PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022395-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 215aa    MW: 24685.8 Da    PI: 9.3076
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022395-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-161259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd ll+++++ +G g W+t++++ g+ R +k+c++rw +yl
    NNU_022395-RA 12 KGPWNPEEDRLLKKYIETHGEGKWATVSKRSGLMRGGKSCRLRWKNYL 59
                     79********************************************97 PP

2Myb_DNA-binding54.13.6e-1765110148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eE++l+++ +++lG++ W++Ia +++ gRt++++k++w+++l
    NNU_022395-RA  65 RGGMTEEEEDLIIRMHNLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 110
                      6789******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.045759IPR017930Myb domain
SMARTSM007172.9E-141161IPR001005SANT/Myb domain
SuperFamilySSF466898.78E-2911106IPR009057Homeodomain-like
PfamPF002491.5E-141259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-231366IPR009057Homeodomain-like
CDDcd001671.96E-111459No hitNo description
PROSITE profilePS5129424.62260114IPR017930Myb domain
SMARTSM007172.8E-1664112IPR001005SANT/Myb domain
PfamPF002491.2E-1565110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2367113IPR009057Homeodomain-like
CDDcd001671.55E-1268110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MEREGTKQVL KKGPWNPEED RLLKKYIETH GEGKWATVSK RSGLMRGGKS CRLRWKNYLR  60
PNIKRGGMTE EEEDLIIRMH NLLGNRWSLI AGRLPGRTDN EVKNYWNTHL IKKYPQCKKV  120
VSDSKRRKLS HSTNSQPICS SSPNSSTMKL DDQGGDKATT SSSNGVNRSA DNDVESQLSA  180
GQETVYEDDF LLQLEPNILF ESQFYFPEEF YPVLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261011325127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241553.11e-160PREDICTED: transcription factor MYB82-like
SwissprotQ9LTF71e-60MYB82_ARATH; Transcription factor MYB82
TrEMBLB9IMW02e-69B9IMW0_POPTR; Uncharacterized protein
STRINGPOPTR_0018s12780.14e-69(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-61myb domain protein 82